Neurogenic Differentiation 4 (NEUROD4) antibody

Antigen: Neurogenic Differentiation 4 (NEUROD4)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Chicken, Dog (Canine), Pig (Porcine), Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN404799

Additional Information

Alternative name: NEUROD4

Gene ID: NEUROD4

UniProt: B2RAC9

Immunogen: The immunogen for anti-NEUROD4 antibody: synthetic peptide directed towards the middle region of human NEUROD4

Sequence: GHMETHLLHLKPQVFKSLGESSFGSHLPDCSTPPYEGPLT PPLSISGNFS

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-NEUROD4 antibody concentration is 1 mg/ml.

Description: The specific function of the protein remains unknown.

Characteristics: Antigen Size: 331 amino acids

Molecular Weight: 37kDa

Application Details

Application Notes: WB Suggested Anti-NEUROD4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Spleen.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Neurology, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-NEUROD4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Spleen

Publications

Product: Horikawa, Horikawa, Cox et al.: "beta-cell transcription factors and diabetes: no evidence for diabetes-associated mutations in the gene encoding the basic helix-loop-helix transcription factor neurogenic differentiation 4 (NEUROD4) in Japanese patients with MODY." in: Diabetes, Vol. 49, Issue 11, pp. 1955-7, 2000 (PubMed).