Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN404889

Zinc Finger and BTB Domain Containing 39 (ZBTB39) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 7030401O21Rik, mKIAA0352, ZNF922, RGD1306532
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN404889
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZBTB39 antibody: synthetic peptide directed towards the middle region of human ZBTB39
Sequence CRLCSQSFKSEAAYRYHVSQHKCNSGLDARPGFGLQHPAL QKRKLPAEEF
Predicted Reactivity Horse : 100%, Pig : 100%, Bovine : 92%, Rabbit : 92%
Characteristics This is a rabbit polyclonal antibody against ZBTB39. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZBTB39
Background ZBTB39 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 1 BTB (POZ) domain and 8 C2H2-type zinc fingers. ZBTB39 may be involved in transcriptional regulation.
Molecular Weight 79kDa
Gene ID 9880
NCBI Accession NP_055645, NM_014830
UniProt O15060
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZBTB39 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Nagase, Ishikawa, Nakajima et al.: "Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro." in: DNA research : an international journal for rapid publication of reports on genes and genomes, Vol. 4, Issue 2, pp. 141-50, 1997 (PubMed).

Alternatives for antigen "Zinc Finger and BTB Domain Containing 39 (ZBTB39)", type "Antibodies"
Hosts (16), (2)
Reactivities (18), (15), (12), (12), (12), (12)
Applications (10), (9), (4), (3), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (2), (1), (1)
Beacon