Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger and BTB Domain Containing 39 (ZBTB39) (Middle Region) antibody

Details for Product No. ABIN404889
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF922, 7030401O21Rik, mKIAA0352, RGD1306532
Epitope
Middle Region
(7), (7), (2)
Reactivity
Human
(22), (12), (12), (12), (12), (12)
Host
Rabbit
(20), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (10), (6), (3), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN404889
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZBTB39
Sequence CRLCSQSFKSEAAYRYHVSQHKCNSGLDARPGFGLQHPAL QKRKLPAEEF
Predicted Reactivity Horse : 100 %, Pig : 100 %, Bovine : 90 %, Rabbit : 90 %
Characteristics This is a rabbit polyclonal antibody against ZBTB39. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZBTB39
Background ZBTB39 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 1 BTB (POZ) domain and 8 C2H2-type zinc fingers. ZBTB39 may be involved in transcriptional regulation.
Molecular Weight 79 kDa
Gene ID 9880
NCBI Accession NM_014830, NP_055645
UniProt O15060
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 712 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger and BTB Domain Containing 39 (ZBTB39) (Middle Region) antibody WB Suggested Anti-ZBTB39 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
Background publications Nagase, Ishikawa, Nakajima et al.: "Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro." in: DNA research : an international journal for rapid publication of reports on genes and genomes, Vol. 4, Issue 2, pp. 141-50, 1997 (PubMed).

Validation Images
back to top