TCDD-Inducible Poly(ADP-Ribose) Polymerase (Tiparp) (N-Term) antibody

Details for Product No. ABIN404897
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ARTD14, AW558171, PARP7, RM1, pART14, TIPARP, fc03g05, sb:cb841, si:dkey-33k14.4, wu:fc03g05, zgc:153056, ddf1, parp7, parp-1, parp-7
Epitope
N-Term
(2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(4)
Host
Rabbit
(4), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(5), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN404897
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TIPARP
Sequence LKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRS RNQSTDENSL
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Rabbit : 90 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against TIPARP. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TIPARP
Background TIPARP is a poly [ADP-ribose] polymerase using NAD+ as a substrate to transfer ADP-ribose onto glutamic acid residues of a protein acceptor, repeated rounds of ADP-ribosylation leads to the formation of poly(ADPribose) chains on the protein, thereby altering the function of the target protein. TIPARP may play a role in the adaptative response to chemical exposure (TCDD) and thereby mediates certain effects of the chemicals.
Molecular Weight 76 kDa
Gene ID 25976
NCBI Accession NM_015508, NP_056323
UniProt Q7Z3E1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 657 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Hosts (4), (1)
Reactivities (4)
Applications (5), (1), (1)
Epitopes (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top