Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN404897

TCDD-Inducible Poly(ADP-Ribose) Polymerase (Tiparp) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ARTD14, AW558171, PARP7, RM1, pART14, TIPARP, fc03g05, sb:cb841, si:dkey-33k14.4, wu:fc03g05, zgc:153056, ddf1, parp7, parp-1, parp-7
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN404897
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TIPARP antibody: synthetic peptide directed towards the N terminal of human TIPARP
Sequence LKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRS RNQSTDENSL
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Rabbit : 91%, Rat : 83%
Characteristics This is a rabbit polyclonal antibody against TIPARP. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TIPARP
Background TIPARP is a poly [ADP-ribose] polymerase using NAD+ as a substrate to transfer ADP-ribose onto glutamic acid residues of a protein acceptor, repeated rounds of ADP-ribosylation leads to the formation of poly(ADPribose) chains on the protein, thereby altering the function of the target protein. TIPARP may play a role in the adaptative response to chemical exposure (TCDD) and thereby mediates certain effects of the chemicals.
Molecular Weight 76kDa
Gene ID 25976
NCBI Accession NP_056323, NM_015508
UniProt Q7Z3E1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TIPARP antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "TCDD-Inducible Poly(ADP-Ribose) Polymerase (Tiparp)", type "Antibodies"
Hosts (8)
Reactivities (5), (2)
Applications (8), (2), (2)
Epitopes (4), (3), (2), (2), (2)
Beacon