BTB (POZ) Domain Containing 2 (BTBD2) (N-Term) antibody

Details for Product No. ABIN404944
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 2610037C03Rik, 4930512K17Rik, btbd1, RGD1566094, btb2l, wz8656, si:dkey-110c1.5, BTBD2
Epitope
N-Term
(1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Human
(6)
Host
Rabbit
(6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1)
Application
Western Blotting (WB)
(6), (4), (4)
Pubmed 1 reference available
Catalog no. ABIN404944
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human BTBD2
Sequence AFLFNNEVLCDVHFLVGKGLSSQRIPAHRFVLAVGSAVFD AMFNGGMATT
Predicted Reactivity Human : 100 %, Mouse : 100 %, Rat : 100 %, African clawed frog : 90 %, Bovine : 80 %
Characteristics This is a rabbit polyclonal antibody against BTBD2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name BTBD2
Background The C-terminus of BTBD2 binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies. The C-terminus of the protein encoded by this gene binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies.
Molecular Weight 56 kDa
Gene ID 55643
NCBI Accession NM_017797, NP_060267
UniProt Q9BX70
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 525 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-BTB (POZ) Domain Containing 2 (BTBD2) (N-Term) antibody WB Suggested Anti-BTBD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome...." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Hosts (6)
Reactivities (6)
Applications (6), (4), (4)
Conjugates (1), (1), (1)
Epitopes (1), (1)
back to top