BTB (POZ) Domain Containing 2 (BTBD2) antibody

Antigen: BTB (POZ) Domain Containing 2 (BTBD2)

Synonyms: 2610037C03Rik, 4930512K17Rik, btb2l, wz8656, si:dkey-110c1.5, btbd1, RGD1566094, BTBD2

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus), Xenopus laevis

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN404944

Additional Information

Alternative name: BTBD2

Gene ID: BTBD2

UniProt: Q9BX70

Immunogen: The immunogen for anti-BTBD2 antibody: synthetic peptide directed towards the N terminal of human BTBD2

Sequence: AFLFNNEVLCDVHFLVGKGLSSQRIPAHRFVLAVGSAVFD AMFNGGMATT

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-BTBD2 antibody concentration is 1 mg/ml.

Description: The C-terminus of BTBD2 binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies. The C-terminus of the protein encoded by this gene binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies.

Characteristics: Antigen Size: 525 amino acids

Molecular Weight: 56kDa

Application Details

Application Notes: WB Suggested Anti-BTBD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-BTBD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate

Publications

Product: Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).