Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Ring Finger Protein 113B (RNF113B) antibody

Antigen

Ring Finger Protein 113B (RNF113B)

Synonyms RNF161, MGC26599, ZNF183L1, bA10G5.1
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN404971
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name RNF113B
Gene ID RNF113B
UniProt Q8IZP6
Immunogen The immunogen for anti-RNF113B antibody: synthetic peptide directed towards the middle region of human RNF113B
Sequence MGATADFEQDTEKEHHTPTILKCSQRVQEALRGREHDHIY RGIHSYLRYL
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-RNF113B antibody concentration is 1 mg/ml.
Description RNF113B contains 1 RING-type zinc finger and 1 C3H1-type zinc finger and the function remains unknown.
Characteristics Antigen Size: 322 amino acids
Molecular Weight 36kDa

Application Details

Application Notes WB Suggested Anti-RNF113B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Dunham, Matthews, Burton et al.: "The DNA sequence and analysis of human chromosome 13." in: Nature, Vol. 428, Issue 6982, pp. 522-8, 2004 (PubMed).

Alternatives

Alternatives for antigen "Ring Finger Protein 113B (RNF113B)", type "Antibodies"
Hosts Rabbit (23), Mouse (5)
Reactivities Human (28), Dog (Canine) (3), Monkey (3), Mouse (Murine) (3), Rat (Rattus) (3)
Applications Immunofluorescence (IF) (18), Western Blotting (WB) (13), ELISA (4), Immunohistochemistry (IHC) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Flow Cytometry (FACS) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes Internal Region (2), C-Term (1)