Chaperonin Containing TCP1, Subunit 8 (Theta)-Like 2 (CCT8L2) (Middle Region) antibody

Details for Product No. ABIN404983
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms CESK1
Epitope
Middle Region
(7), (1), (1), (1)
Reactivity
Human
(33)
Host
Rabbit
(19), (15)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(23), (9), (7), (5), (5), (4), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN404983
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human CCT8L2
Sequence AGINVAVVLGEVDEETLTLADKYGIVVIQARSWMEIIYLS EVLDTPLLPR
Predicted Reactivity Rabbit : 83 %
Characteristics This is a rabbit polyclonal antibody against CCT8L2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CCT8L2
Background CCT8L2 belongs to the TCP-1 chaperonin family. It possible molecular chaperone and assists the folding of proteins upon ATP hydrolysis.
Molecular Weight 59 kDa
Gene ID 150160
NCBI Accession NM_014406, NP_055221
UniProt Q96SF2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 557 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chaperonin Containing TCP1, Subunit 8 (Theta)-Like 2 (CCT8L2) (Middle Region) antibody WB Suggested Anti-CCT8L2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Hosts (19), (15)
Reactivities (33)
Applications (23), (9), (7), (5), (5), (4), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (1), (1), (1)
back to top