Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN404983

Chaperonin Containing TCP1, Subunit 8 (Theta)-Like 2 (CCT8L2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CESK1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN404983
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CCT8L2 antibody: synthetic peptide directed towards the middle region of human CCT8L2
Sequence AGINVAVVLGEVDEETLTLADKYGIVVIQARSWMEIIYLS EVLDTPLLPR
Predicted Reactivity Rabbit : 83%
Characteristics This is a rabbit polyclonal antibody against CCT8L2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CCT8L2
Background CCT8L2 belongs to the TCP-1 chaperonin family. It possible molecular chaperone and assists the folding of proteins upon ATP hydrolysis.
Molecular Weight 59kDa
Gene ID 150160
NCBI Accession NP_055221, NM_014406
UniProt Q96SF2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CCT8L2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives for antigen "Chaperonin Containing TCP1, Subunit 8 (Theta)-Like 2 (CCT8L2)", type "Antibodies"
Hosts (16), (15)
Reactivities (30)
Applications (21), (9), (9), (5), (5), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (1), (1), (1)
Beacon