Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 45 (ZNF45) antibody

Antigen

Zinc Finger Protein 45 (ZNF45)

Synonyms KOX5, ZNF13
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405008
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ZNF45
Gene ID ZNF45
UniProt Q02386
Immunogen The immunogen for anti-ZNF45 antibody: synthetic peptide directed towards the middle region of human ZNF45
Sequence RVHTGEKPYKCEECGKGFSWSSSLIIHQRVHADDEGDKDF PSSEDSHRKT
Cross-Reactivity Cow (Bovine), Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ZNF45 antibody concentration is 1 mg/ml.
Description ZNF45 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 18 C2H2-type zinc fingers and 1 KRAB domain. ZNF45 may be involved in transcriptional regulation.
Characteristics Antigen Size: 682 amino acids
Molecular Weight 78kDa

Application Details

Application Notes WB Suggested Anti-ZNF45 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Transfected 293T.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only

Publications

Product Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger Protein 45 (ZNF45)", type "Antibodies"
Hosts Rabbit (4)
Reactivities Human (4)
Applications Western Blotting (WB) (4), ELISA (2)
Epitopes Internal Region (1), N-Term (1)