Zinc Finger Protein 74 (ZNF74) antibody

Antigen: Zinc Finger Protein 74 (ZNF74)

Synonyms: ZNF74

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN405009

Additional Information

Alternative name: ZNF74

Gene ID: ZNF74

UniProt: Q6PJP1

Immunogen: The immunogen for anti-ZNF74 antibody: synthetic peptide directed towards the middle region of human ZNF74

Sequence: RLCAGENASTPSEPEKFPQVRRQRGAGAGEGEFVCGECGK AFRQSSSLTL

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF74 antibody concentration is 1 mg/ml.

Description: ZNF74 contains 1 KRAB domain. The exact function of ZNF74 is not known.

Characteristics: Antigen Size: 644 amino acids

Molecular Weight: 72kDa

Application Details

Application Notes: WB Suggested Anti-ZNF74 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF74 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate

Publications

Product: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).