Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 197 (ZNF197) antibody

Antigen

Zinc Finger Protein 197 (ZNF197)

Synonyms ZNF197
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Dog (Canine)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405021
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ZNF197
Gene ID ZNF197
UniProt Q86VG0
Immunogen The immunogen for anti-ZNF197 antibody: synthetic peptide directed towards the N terminal of human ZNF197
Sequence MTRENVAHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWET SHLHFRQLRY
Cross-Reactivity Cow (Bovine), Dog (Canine), Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ZNF197 antibody concentration is 1 mg/ml.
Description ZNF197 belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas. This gene product belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The encoded protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas. This gene is located in a cluster of zinc finger genes at 3p21. Two alternatively spliced transcripts encoding different isoforms have been described.
Characteristics Antigen Size: 267 amino acids
Molecular Weight 30kDa

Application Details

Application Notes WB Suggested Anti-ZNF197 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only

Publications

Product Li, Wang, Na et al.: "The VHL protein recruits a novel KRAB-A domain protein to repress HIF-1alpha transcriptional activity." in: The EMBO journal, Vol. 22, Issue 8, pp. 1857-67, 2003 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger Protein 197 (ZNF197)", type "Antibodies"
Hosts Rabbit (7)
Reactivities Human (7), Cow (Bovine) (2), Dog (Canine) (1)
Applications Western Blotting (WB) (7), ELISA (4), Immunohistochemistry (IHC) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1)
Epitopes N-Term (3), Internal Region (1)