Zinc Finger Protein 180 (ZNF180) antibody

Antigen: Zinc Finger Protein 180 (ZNF180)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN405026

Additional Information

Alternative name: ZNF180

Gene ID: ZNF180

UniProt: Q9UJW8

Immunogen: The immunogen for anti-ZNF180 antibody: synthetic peptide directed towards the middle region of human ZNF180

Sequence: LHIHEKIHGGGKTFDFKECGQVLNPKISHNEQQRIPFEES QYKCSETSHS

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF180 antibody concentration is 1 mg/ml.

Description: ZNF180 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZNF180 may be involved in transcriptional regulation.Zinc finger proteins have been shown to interact with nucleic acids and to have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form 1 family of zinc finger proteins. See MIM 604749 for additional information on zinc finger proteins.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2361 AK315193.1 1-2361 2362-2395 AF192913.1 2345-2378 2396-2832 DB496139.1 43-479 2833-3140 AI472318.1 1-308 c

Characteristics: Antigen Size: 692 amino acids

Molecular Weight: 79kDa

Application Details

Application Notes: WB Suggested Anti-ZNF180 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF180 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate

Publications

Product: Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).