Zinc Finger Protein 221 (ZNF221) (N-Term) antibody

Details for Product No. ABIN405027
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(1)
Reactivity
Human
(2)
Host
Rabbit
(1), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405027
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF221
Sequence METVPEAGPHEEWSCQQIWEQIASDLTRSQNSIRNSSQFF KEGDVPCQIE
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against ZNF221. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF221
Background ZNF221 may be involved in transcriptional regulation.
Molecular Weight 71 kDa
Gene ID 7638
NCBI Accession NM_013359, NP_037491
UniProt Q9UK13
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 617 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 221 (ZNF221) (N-Term) antibody WB Suggested Anti-ZNF221 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
Background publications Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).

Validation Images
back to top