Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 434 (ZNF434) (N-Term) antibody

Details for Product No. ABIN405034
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF434
Epitope
N-Term
(4), (3), (1), (1)
Reactivity
Human
(12)
Host
Rabbit
(7), (5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(12), (3), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405034
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF434
Sequence GSDIEAGELNHQNGEPTEVEDGTVDGADRDEKDFRNPGQE VRKLDLPVLF
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF434. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF434
Background ZNF434 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 6 C2H2-type zinc fingers and 1 KRAB domain. ZNF434 may be involved in transcriptional regulation.
Molecular Weight 55 kDa
Gene ID 54925
NCBI Accession NM_017810, NP_060280
UniProt Q9NX65
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 485 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 434 (ZNF434) (N-Term) antibody WB Suggested Anti-ZNF434 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: Jurkat cell lysate
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Hosts (7), (5)
Reactivities (12)
Applications (12), (3), (3), (1)
Epitopes (4), (3), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405034
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top