Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405034

Zinc Finger Protein 434 (ZNF434) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF434
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405034
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF434 antibody: synthetic peptide directed towards the N terminal of human ZNF434
Sequence GSDIEAGELNHQNGEPTEVEDGTVDGADRDEKDFRNPGQE VRKLDLPVLF
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF434. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF434
Background ZNF434 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 6 C2H2-type zinc fingers and 1 KRAB domain. ZNF434 may be involved in transcriptional regulation.
Molecular Weight 55kDa
Gene ID 54925
NCBI Accession NP_060280, NM_017810
UniProt Q9NX65
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF434 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Alternatives for antigen "Zinc Finger Protein 434 (ZNF434)", type "Antibodies"
Hosts (5), (4)
Reactivities (9)
Applications (9), (3), (2)
Epitopes (4), (2), (1), (1)
Beacon