Zinc Finger Protein 434 (ZNF434) antibody

Antigen: Zinc Finger Protein 434 (ZNF434)

Synonyms: MGC4179, FLJ20417, FLJ31901

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN405034

Additional Information

Alternative name: ZNF434

Gene ID: ZNF434

UniProt: Q9NX65

Immunogen: The immunogen for anti-ZNF434 antibody: synthetic peptide directed towards the N terminal of human ZNF434

Sequence: GSDIEAGELNHQNGEPTEVEDGTVDGADRDEKDFRNPGQE VRKLDLPVLF

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF434 antibody concentration is 1 mg/ml.

Description: ZNF434 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 6 C2H2-type zinc fingers and 1 KRAB domain. ZNF434 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 485 amino acids

Molecular Weight: 55kDa

Application Details

Application Notes: WB Suggested Anti-ZNF434 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF434 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: Jurkat cell lysate

Publications

Product: Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).