Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

TGFB-Induced Factor Homeobox 2-Like, X-Linked (TGIF2LX) antibody

Antigen

TGFB-Induced Factor Homeobox 2-Like, X-Linked (TGIF2LX)

Synonyms TGIFLX, MGC34726
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405058
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name TGIF2LX
Gene ID TGIF2LX
UniProt Q8IUE1
Immunogen The immunogen for anti-TGIF2LX antibody: synthetic peptide directed towards the middle region of human TGIF2LX
Sequence SGPSGPDNVQSLPLWPLPKGQMSREKQPDPESAPSQKLTG IAQPKKKVKV
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-TGIF2LX antibody concentration is 1 mg/ml.
Description TGIF2LX is a member of the TALE/TGIF homeobox family of transcription factors. Testis-specific expression suggests that this gene may play a role in spermatogenesis. This gene encodes a member of the TALE/TGIF homeobox family of transcription factors. Testis-specific expression suggests that this gene may play a role in spermatogenesis. A homolog of this gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition.
Characteristics Antigen Size: 241 amino acids
Molecular Weight 27kDa

Application Details

Application Notes WB Suggested Anti-TGIF2LX Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only

Publications

Product Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Alternatives

Alternatives for antigen "TGFB-Induced Factor Homeobox 2-Like, X-Linked (TGIF2LX)", type "Antibodies"
Hosts Rabbit (7)
Reactivities Human (6)
Applications Western Blotting (WB) (6), ELISA (4)
Epitopes Internal Region (2), Internal Region,AA 149-175 (1)