DEAH (Asp-Glu-Ala-His) Box Polypeptide 35 (DHX35) antibody

Antigen: DEAH (Asp-Glu-Ala-His) Box Polypeptide 35 (DHX35)

Synonyms: Ddx35, 1200009D07Rik, MGC146350

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN405092

Additional Information

Alternative name: DHX35

Gene ID: DHX35

UniProt: Q9H5Z1

Immunogen: The immunogen for anti-DHX35 antibody: synthetic peptide directed towards the N terminal of human DHX35

Sequence: MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYN PYAALSIEQQ

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-DHX35 antibody concentration is 1 mg/ml.

Description: DEAD box proteins characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The function of DHX35 which is a member of this family, has not been determined.DEAD box proteins characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The function of this gene product which is a member of this family, has not been determined.

Characteristics: Antigen Size: 703 amino acids

Molecular Weight: 79kDa

Application Details

Application Notes: WB Suggested Anti-DHX35 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-DHX35 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart

Publications

Product: Jurica, Licklider, Gygi et al.: "Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis." in: RNA (New York, N.Y.), Vol. 8, Issue 4, pp. 426-39, 2002 (PubMed).