Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Annexin A8 (ANXA8) antibody

Antigen

Annexin A8 (ANXA8)

Synonyms ANX8, FLJ53095, Anx8, AI466995, MGC40628, ANXA8, ANXA8L1, MGC137766, MGC116246, ANXA8L2, anx8, MGC85309, FLJ32754, FLJ54151, bA145E20.2, LOC100008655
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Rat (Rattus), Mouse (Murine), Rabbit, Zebrafish, Dog (Canine), Chicken

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405098
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Annexin A8 / ANXA8
Gene ID ANXA8L2
UniProt P13928
Immunogen The immunogen for anti-ANXA8L2 antibody: synthetic peptide directed towards the middle region of human ANXA8L2
Sequence VFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLH SYFAERLYYA
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rabbit, Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ANXA8L2 antibody concentration is 1 mg/ml.
Description ANXA8L2 is a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.
Characteristics Antigen Size: 327 amino acids
Molecular Weight 37kDa

Application Details

Application Notes WB Suggested Anti-ANXA8L2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Extracellular Matrix
Restrictions For Research Use only

Publications

Product Karanjawala, Illei, Ashfaq et al.: "New markers of pancreatic cancer identified through differential gene expression analyses: claudin 18 and annexin A8." in: The American journal of surgical pathology, Vol. 32, Issue 2, pp. 188-96, 2008 (PubMed).

Alternatives

Alternatives for antigen "Annexin A8 (ANXA8)", type "Antibodies"
Hosts Rabbit (26)
Reactivities Human (24), Cow (Bovine) (17), Dog (Canine) (17), Horse (Equine) (17), Mouse (Murine) (17), Rat (Rattus) (17)
Applications Immunofluorescence (IF) (14), Western Blotting (WB) (11), ELISA (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Flow Cytometry (FACS) (1), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes Center (2), N-Term (1)