Did you know that you can buy products from over 140 different suppliers from us?

Gap Junction Protein, alpha 9, 59kDa (GJA9) (Middle Region) antibody

Details for Product No. ABIN405104
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CX58, CX59, GJA10
Epitope
Middle Region
(8), (6), (1)
Reactivity
Human
(20), (1), (1)
Host
Rabbit
(21)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(15), (13), (12), (3)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405104
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human GJA9
Sequence IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHEN RGSPPKGNLK
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against GJA9. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name GJA9
Background Connexins, such as GJA9, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits.Connexins, such as GJA9, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits (Sohl et al., 2003 [PubMed 12881038]).
Molecular Weight 59 kDa
Gene ID 81025
NCBI Accession NM_030772, NP_110399
UniProt P57773
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 515 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Terrier-Lacombe, Guillou, Maire et al.: "Dermatofibrosarcoma protuberans, giant cell fibroblastoma, and hybrid lesions in children: clinicopathologic comparative analysis of 28 cases with molecular data--a study from the French Federation of Cancer Centers Sarcoma Group." in: The American journal of surgical pathology, Vol. 27, Issue 1, pp. 27-39, 2002 (PubMed).

Background publications Söhl, Nielsen, Eiberger et al.: "Expression profiles of the novel human connexin genes hCx30.2, hCx40.1, and hCx62 differ from their putative mouse orthologues." in: Cell communication & adhesion, Vol. 10, Issue 1, pp. 27-36, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405104
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top