Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405104

Gap Junction Protein, alpha 9, 59kDa (GJA9) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CX58, CX59, GJA10
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN405104
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GJA9 antibody: synthetic peptide directed towards the middle region of human GJA9
Sequence IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHEN RGSPPKGNLK
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against GJA9. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name GJA9
Background Connexins, such as GJA9, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits.Connexins, such as GJA9, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits (Sohl et al., 2003 [PubMed 12881038]).
Molecular Weight 59kDa
Gene ID 81025
NCBI Accession NP_110399, NM_030772
UniProt P57773
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GJA9 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Terrier-Lacombe, Guillou, Maire et al.: "Dermatofibrosarcoma protuberans, giant cell fibroblastoma, and hybrid lesions in children: clinicopathologic comparative analysis of 28 cases with molecular data--a study from the French Federation of Cancer Centers Sarcoma Group." in: The American journal of surgical pathology, Vol. 27, Issue 1, pp. 27-39, 2002 (PubMed).

Background publications Söhl, Nielsen, Eiberger et al.: "Expression profiles of the novel human connexin genes hCx30.2, hCx40.1, and hCx62 differ from their putative mouse orthologues." in: Cell communication & adhesion, Vol. 10, Issue 1, pp. 27-36, 2003 (PubMed).

Alternatives for antigen "Gap Junction Protein, alpha 9, 59kDa (GJA9)", type "Antibodies"
Hosts (8)
Reactivities (7), (1)
Applications (5), (4), (4)
Epitopes (2), (1)
Beacon