Gap Junction Protein, alpha 9, 59kDa (GJA9) antibody

Antigen: Gap Junction Protein, alpha 9, 59kDa (GJA9)

Synonyms: CX58, CX59, GJA10, MGC50985

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN405104

Additional Information

Alternative name: GJA9 / Cx58

Gene ID: GJA9

UniProt: P57773

Immunogen: The immunogen for anti-GJA9 antibody: synthetic peptide directed towards the middle region of human GJA9

Sequence: IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHEN RGSPPKGNLK

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-GJA9 antibody concentration is 1 mg/ml.

Description: Connexins, such as GJA9, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits.Connexins, such as GJA9, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits (Sohl et al., 2003 [PubMed 12881038]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-612 BI463634.1 7-618 613-1929 AF271261.1 585-1901 1930-2331 BU689816.1 1-402 c

Characteristics: Antigen Size: 515 amino acids

Molecular Weight: 59kDa

Application Details

Application Notes: WB Suggested Anti-GJA9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-GJA9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain

Publications

Product: Terrier-Lacombe, Guillou, Maire et al.: "Dermatofibrosarcoma protuberans, giant cell fibroblastoma, and hybrid lesions in children: clinicopathologic comparative analysis of 28 cases with molecular data--a study from the French Federation of Cancer Centers Sarcoma Group." in: The American journal of surgical pathology, Vol. 27, Issue 1, pp. 27-39, 2002 (PubMed).

Söhl, Nielsen, Eiberger et al.: "Expression profiles of the novel human connexin genes hCx30.2, hCx40.1, and hCx62 differ from their putative mouse orthologues." in: Cell communication & adhesion, Vol. 10, Issue 1, pp. 27-36, 2003 (PubMed).