Did you know that you can buy products from over 140 different suppliers from us?

Rhox Homeobox Family, Member 2 (RHOXF2) (Middle Region) antibody

Details for Product No. ABIN405122
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CT107, PEPP-2, PEPP2, THG1
Epitope
Middle Region
(9), (8), (5), (2), (1), (1)
Reactivity
Human
(20), (2), (2)
Host
Rabbit
(14), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(20), (11), (9), (4), (4), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405122
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RHOXF2
Sequence DQSEKEPGQQYSRPQGAVGGLEPGNAQQPNVHAFTPLQLQ ELERIFQREQ
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against RHOXF2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RHOXF2
Background RHOXF2 belongs to the paired-like homeobox family, PEPP subfamily. It contains 1 homeobox DNA-binding domain. The function of RHOXF2 remains unknown.
Molecular Weight 32 kDa
Gene ID 84528
NCBI Accession NM_032498, NP_115887
UniProt Q9BQY4
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 288 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Rhox Homeobox Family, Member 2 (RHOXF2) (Middle Region) antibody WB Suggested Anti-RHOXF2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate
anti-Rhox Homeobox Family, Member 2 (RHOXF2) (Middle Region) antibody (2) anti-Rhox Homeobox Family, Member 2 (RHOXF2) (Middle Region) antibody (Image 2)
Background publications Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).

Hosts (14), (6)
Reactivities (20), (2), (2)
Applications (20), (11), (9), (4), (4), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (9), (8), (5), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405122
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top