Zinc Finger Protein 511 (ZNF511) (N-Term) antibody

Details for Product No. ABIN405124
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 2410004P19Rik, C86579, Znf511
Epitope
N-Term
(2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(9)
Host
Rabbit
(6), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN405124
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF511
Sequence MQLPPALCARLAAGPGAAEPLPVERDPAAGAAPFRFVARP VRFPREHQFF
Predicted Reactivity Guinea pig : 92 %, Pig : 82 %
Characteristics This is a rabbit polyclonal antibody against ZNF511. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF511
Background ZNF511 may be involved in transcriptional regulation.
Molecular Weight 28 kDa
Gene ID 118472
NCBI Accession NM_145806, NP_665805
UniProt Q8NB15
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 252 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10...." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Hosts (6), (3)
Reactivities (9)
Applications (8), (3), (2)
Epitopes (2), (2), (1), (1), (1)
back to top