Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

BUD31 Homolog (S. Cerevisiae) (BUD31) antibody

Antigen

BUD31 Homolog (S. Cerevisiae) (BUD31)
Synonyms g10l, zgc:110615, BUD31, MGC137430, CWC14, LOC100221237, bud31, G10, EDG2, EDG-2, fSAP17, YCR063W, MGC111202, Edg2, C77604, g10, MGC52613, c77604
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Caenorhabditis elegans (C. elegans), Dog (Canine)
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405158
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-BUD31 Homolog (S. Cerevisiae) (BUD31) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name BUD31 / EDG2
Gene ID BUD31
UniProt P41223
Immunogen The immunogen for anti-BUD31 antibody: synthetic peptide directed towards the N terminal of human BUD31
Sequence PKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKR KVESLWPIFR
Cross-Reactivity Cow (Bovine), Caenorhabditis elegans (C. elegans), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-BUD31 antibody concentration is 1 mg/ml.
Description The exact function of BUD31 remains unknown.
Characteristics Antigen Size: 144 amino acids
Molecular Weight 17kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-BUD31 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Hillier, Fulton, Fulton et al.: "The DNA sequence of human chromosome 7." in: Nature, Vol. 424, Issue 6945, pp. 157-64, 2003 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "BUD31 Homolog (S. Cerevisiae) (BUD31)", type "Antibodies"
Hosts Rabbit (11), Mouse (4)
Reactivities Human (15), Rat (Rattus) (5), Mouse (Murine) (4), Dog (Canine) (3), Chicken (2), Xenopus laevis (2), Caenorhabditis elegans (C. elegans) (1), Cat (Feline) (1), Cow (Bovine) (1), Zebrafish (1), Zebrafish (Danio rerio) (1)
Applications Western Blotting (WB) (13), ELISA (8), Immunohistochemistry (IHC) (4), Immunofluorescence (IF) (2), Dot Blot (DB) (1), Dot Blot (Dot) (1), Immunoprecipitation (IP) (1)
Epitopes N-Term (2), Center (1), Internal Region (1), Met10 (1)