Zinc Finger Protein 197 (ZNF197) antibody

Antigen: Zinc Finger Protein 197 (ZNF197)

Synonyms: ZNF197

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human

Application: Western Blotting (WB)

Catalog no.: ABIN405180

Additional Information

Alternative name: ZNF197

Gene ID: ZNF197

UniProt: O14709

Immunogen: The immunogen for anti-ZNF197 antibody: synthetic peptide directed towards the middle region of human ZNF197

Sequence: NLTVHQKIHTDEKPCECDVSEKEFSQTSNLHLQQKIHTIE EFSWLQNTNE

Cross-Reactivity: Cow (Bovine), Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF197 antibody concentration is 1 mg/ml.

Description: ZNF197 belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas. This gene product belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The encoded protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas. This gene is located in a cluster of zinc finger genes at 3p21. Two alternatively spliced transcripts encoding different isoforms have been described.

Characteristics: Antigen Size: 1029 amino acids

Molecular Weight: 119kDa

Application Details

Application Notes: WB Suggested Anti-ZNF197 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF197 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate

Publications

Product: Li, Wang, Na et al.: "The VHL protein recruits a novel KRAB-A domain protein to repress HIF-1alpha transcriptional activity." in: The EMBO journal, Vol. 22, Issue 8, pp. 1857-67, 2003 (PubMed).