Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405193

Zinc Finger Protein 112 Homolog (Mouse) (ZFP112) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF112, ZNF228
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405193
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF228 antibody: synthetic peptide directed towards the N terminal of human ZNF228
Sequence VTFKDVAVVFTEEELGLLDSVQRKLYRDVMLENFRNLLLV AHQPFKPDLI
Predicted Reactivity Bovine :92%,   Dog :85%,   Green monkey :85%,   Sumatran orangutan :85%,   Human :100%,   Mouse :84%,   Rat :84%,  
Characteristics This is a rabbit polyclonal antibody against ZNF228. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF228
Background ZNF228 contains 1 KRAB domain. The function of ZNF228 remains unknown.
Molecular Weight 105kDa
Gene ID 7771
NCBI Accession NP_037512, NM_013380
UniProt Q0VG01
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF228 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).

Alternatives for antigen "Zinc Finger Protein 112 Homolog (Mouse) (ZFP112)", type "Antibodies"
Hosts (4), (2)
Reactivities (5)
Applications (4), (3)
Epitopes (1), (1)
Beacon