Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 112 Homolog (Mouse) (ZFP112) (N-Term) antibody

Details for Product No. ABIN405193
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1110008J21Rik, AI225886, AW549494, Zfp228, Zfp313, Znf228, ZNF112, ZNF228
Epitope
N-Term
(1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(6)
Host
Rabbit
(3), (3), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(4), (4), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405193
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF228
Sequence VTFKDVAVVFTEEELGLLDSVQRKLYRDVMLENFRNLLLV AHQPFKPDLI
Predicted Reactivity Bovine :92 %,   Dog :82 %,   Green monkey :82 %,   Sumatran orangutan :82 %,   Human :102 %,   Mouse :82 %,   Rat :82 %,  
Characteristics This is a rabbit polyclonal antibody against ZNF228. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF228
Background ZNF228 contains 1 KRAB domain. The function of ZNF228 remains unknown.
Molecular Weight 105 kDa
Gene ID 7771
NCBI Accession NM_013380, NP_037512
UniProt Q0VG01
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 907 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 112 Homolog (Mouse) (ZFP112) (N-Term) antibody WB Suggested Anti-ZNF228 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate
Background publications Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).

Validation Images
back to top