Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 112 Homolog (Mouse) (ZFP112) antibody

Antigen

Zinc Finger Protein 112 Homolog (Mouse) (ZFP112)

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405193
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ZNF228
Gene ID ZNF228
UniProt Q0VG01
Immunogen The immunogen for anti-ZNF228 antibody: synthetic peptide directed towards the N terminal of human ZNF228
Sequence VTFKDVAVVFTEEELGLLDSVQRKLYRDVMLENFRNLLLV AHQPFKPDLI
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ZNF228 antibody concentration is 1 mg/ml.
Description ZNF228 contains 1 KRAB domain. The function of ZNF228 remains unknown.
Characteristics Antigen Size: 907 amino acids
Molecular Weight 105kDa

Application Details

Application Notes WB Suggested Anti-ZNF228 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger Protein 112 Homolog (Mouse) (ZFP112)", type "Antibodies"
Hosts Goat (2), Rabbit (2)
Reactivities Human (3)
Applications ELISA (3), Western Blotting (WB) (2)
Epitopes Internal Region (1), N-Term (1)