Did you know that you can buy products from over 140 different suppliers from us?

B-Cell CLL/lymphoma 11A (Zinc Finger Protein) (BCL11A) (N-Term) antibody

Details for Product No. ABIN405218
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2810047E18Rik, BCL-11A, Ctip1, D930021L15Rik, Evi9, Evi9a, Evi9b, Evi9c, mKIAA1809, BCL11A-L, BCL11A-S, BCL11A-XL, BCL11a-M, CTIP1, EVI9, HBFQTL5, ZNF856, bcl11a, wu:fi09f10, zgc:136898
Epitope
N-Term
(16), (10), (4), (3), (2), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Cow (Bovine), Dog (Canine), Xenopus laevis, Human, Chicken
(50), (17), (17), (12)
Host
Rabbit
(45), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(43), (18), (10), (9), (7), (3), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405218
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human BCL11A
Sequence MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPE GDHDLLTCGQ
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Zebrafish : 100 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against BCL11A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name BCL11A
Background BCL11A Is a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression.This gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression. Multiple transcript variants encoding several different isoforms have been found for this gene.
Molecular Weight 91 kDa
Gene ID 53335
NCBI Accession NM_022893, NP_075044
UniProt Q9H165
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 835 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-B-Cell CLL/lymphoma 11A (Zinc Finger Protein) (BCL11A) (N-Term) antibody anti-B-Cell CLL/lymphoma 11A (Zinc Finger Protein) (BCL11A) (N-Term) antibody
Product cited in: Uda, Galanello, Sanna et al.: "Genome-wide association study shows BCL11A associated with persistent fetal hemoglobin and amelioration of the phenotype of beta-thalassemia." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 5, pp. 1620-5, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405218
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top