B-Cell CLL/lymphoma 11A (Zinc Finger Protein) (BCL11A) antibody

Antigen: B-Cell CLL/lymphoma 11A (Zinc Finger Protein) (BCL11A)

Synonyms: Evi9, Ctip1, BCL-11A, mKIAA1809, 2810047E18Rik, D930021L15Rik, EVI9, CTIP1, ZNF856, HBFQTL5, BCL11A-L, BCL11A-S, FLJ10173, FLJ34997, KIAA1809, BCL11A-XL, MGC136898, wu:fi09f10, zgc:136898

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Dog (Canine), Chicken, Xenopus laevis

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN405218

Additional Information

Alternative name: Bcl-11A

Gene ID: BCL11A

UniProt: Q9H165

Immunogen: The immunogen for anti-BCL11A antibody: synthetic peptide directed towards the N terminal of human BCL11A

Sequence: MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPE GDHDLLTCGQ

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-BCL11A antibody concentration is 1 mg/ml.

Description: BCL11A Is a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression.This gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression. Multiple transcript variants encoding several different isoforms have been found for this gene.

Characteristics: Antigen Size: 835 amino acids

Molecular Weight: 91kDa

Application Details

Application Notes: WB Suggested Anti-BCL11A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-BCL11A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart

anti-B-Cell CLL/lymphoma 11A (Zinc Finger Protein) (BCL11A) antibody (Image 2)

Publications

Product: Uda, Galanello, Sanna et al.: "Genome-wide association study shows BCL11A associated with persistent fetal hemoglobin and amelioration of the phenotype of beta-thalassemia." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 5, pp. 1620-5, 2008 (PubMed).