Zinc Finger Protein 335 (ZNF335) (Middle Region) antibody

Details for Product No. ABIN405249
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms MCPH10, NIF-1, NIF1, NIF2, 1810045J01Rik, Nif1, Znf335, Nif
Epitope
Middle Region
(1), (1), (1)
Reactivity
Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(11), (3), (1)
Host
Rabbit
(10), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(11), (6), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN405249
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZNF335
Sequence EAAAHSAVTAVADAAMAQAQGLFGTDETVPEHIQQLQHQG IEYDVITLAD
Predicted Reactivity Human : 100 %, Rabbit : 90 %, Bovine : 80 %, Dog : 80 %, Horse : 80 %, Pig : 80 %
Characteristics This is a rabbit polyclonal antibody against ZNF335. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF335
Background ZNF335 enhances transcriptional activation by ligand-bound nuclear hormone receptors. However, it does this not by direct interaction with the receptor, but by direct interaction with the nuclear hormone receptor transcriptional coactivator NRC. ZNF335 may function by altering local chromatin structure.The protein encoded by this gene enhances transcriptional activation by ligand-bound nuclear hormone receptors. However, it does this not by direct interaction with the receptor, but by direct interaction with the nuclear hormone receptor transcriptional coactivator NRC. The encoded protein may function by altering local chromatin structure.
Molecular Weight 145 kDa
Gene ID 63925
NCBI Accession NM_022095, NP_071378
UniProt Q9H4Z2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1342 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Garapaty, Mahajan, Samuels: "Components of the CCR4-NOT complex function as nuclear hormone receptor coactivators via association with the NRC-interacting Factor NIF-1." in: The Journal of biological chemistry, Vol. 283, Issue 11, pp. 6806-16, 2008 (PubMed).

Hosts (10), (1)
Reactivities (11), (3), (1)
Applications (11), (6), (2), (1)
Epitopes (1), (1), (1)
back to top