Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2) antibody

Antigen: Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2)

Synonyms: p97, AAG1, DAP5, NAT1, FLJ41344, EIF4G2, NAT1B, eif4g2, hm:zeh1307, wu:fa14h01, wu:fb44h01, wu:fb59c06, wu:fc21b05, DKFZp459D102

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Rabbit, Xenopus laevis, Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN405317

Additional Information

Alternative name: EIF4G2 / DAP5

Gene ID: EIF4G2

UniProt: P78344

Immunogen: The immunogen for anti-EIF4G2 antibody: synthetic peptide directed towards the N terminal of human EIF4G2

Sequence: PNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVD VYDKRENPLL

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rabbit, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-EIF4G2 antibody concentration is 1 mg/ml.

Description: Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. EIF4G2 shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3, eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, EIF4G2 functions as a general repressor of translation by forming translationally inactive complexes. Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3, eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.

Characteristics: Antigen Size: 907 amino acids

Molecular Weight: 102kDa

Application Details

Application Notes: WB Suggested Anti-EIF4G2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-EIF4G2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate

Publications

Product: Nousch, Reed, Bryson-Richardson et al.: "The eIF4G-homolog p97 can activate translation independent of caspase cleavage." in: RNA (New York, N.Y.), Vol. 13, Issue 3, pp. 374-84, 2007 (PubMed).