MIF4G Domain Containing (MIF4GD) antibody

Antigen: MIF4G Domain Containing (MIF4GD)

Synonyms: MIFD, AD023, SLIP1, MGC45027, 1110014L05Rik, 2310075G12Rik, RGD1309685, MIF4GD

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Rat (Rattus), Mouse (Murine), Dog (Canine), Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN405365

Additional Information

Alternative name: MIF4GD / SLIP1

Gene ID: MIF4GD

UniProt: A9UHW6-2

Immunogen: The immunogen for anti-MIF4GD antibody: synthetic peptide directed towards the N terminal of human MIF4GD

Sequence: MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSV CQRSYSNCSR

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MIF4GD antibody concentration is 1 mg/ml.

Description: MIF4GD is a protein which contains an MIF4G domain. This gene encodes a protein which contains an MIF4G domain.

Characteristics: Antigen Size: 256 amino acids

Molecular Weight: 29kDa

Application Details

Application Notes: WB Suggested Anti-MIF4GD Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-MIF4GD Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta

Publications

Product: Cakmakci, Lerner, Wagner et al.: "SLIP1, a factor required for activation of histone mRNA translation by the stem-loop binding protein." in: Molecular and cellular biology, Vol. 28, Issue 3, pp. 1182-94, 2008 (PubMed).