Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Solute Carrier Family 22 (Organic Anion Transporter), Member 8 (SLC22A8) antibody

Antigen

Solute Carrier Family 22 (Organic Anion Transporter), Member 8 (SLC22A8)
Synonyms OAT3, MGC24086, SLC22A8, DKFZp469B1012
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rabbit, Dog (Canine)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405412
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Solute Carrier Family 22 (Organic Anion Transporter), Member 8 (SLC22A8) antibody

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name SLC22A8 / OAT3
Gene ID SLC22A8
UniProt Q8TCC7
Immunogen The immunogen for anti-SLC22A8 antibody: synthetic peptide directed towards the middle region of human SLC22A8
Sequence PETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPL QPHGPGLGSS
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rabbit
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-SLC22A8 antibody concentration is 1 mg/ml.
Description SLC22A8 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. SLC22A8 is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Characteristics Antigen Size: 542 amino acids
Molecular Weight 60kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-SLC22A8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human heart.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Windass, Lowes, Wang et al.: "The contribution of organic anion transporters OAT1 and OAT3 to the renal uptake of rosuvastatin." in: The Journal of pharmacology and experimental therapeutics, Vol. 322, Issue 3, pp. 1221-7, 2007 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "Solute Carrier Family 22 (Organic Anion Transporter), Member 8 (SLC22A8)", type "Antibodies"
Hosts Rabbit (29)
Reactivities Human (25), Rat (Rattus) (23), Mouse (Murine) (19)
Applications Immunofluorescence (IF) (16), Western Blotting (WB) (13), ELISA (9), Immunohistochemistry (IHC) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (2), N-Term (2), Internal Region (1)