Arylsulfatase E (ARSE) antibody

Antigen: Arylsulfatase E (ARSE)

Synonyms: CDPX, CDPX1, CDPXR, MGC163310, ARSE, MGC155058

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN405416

Additional Information

Alternative name: Arylsulfatase E

Gene ID: ARSE

UniProt: P51690

Immunogen: The immunogen for anti-ARSE antibody: synthetic peptide directed towards the middle region of human ARSE

Sequence: KVVHHDPPLLFDLSRDPSETHILTPASEPVFYQVMERVQQ AVWEHQRTLS

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ARSE antibody concentration is 1 mg/ml.

Description: Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene.Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-170 AC005295.1 87561-87730 c 171-744 AK223183.1 1-574 745-2036 AK223199.1 542-1833 2037-2220 AW779826.1 1-184 c

Characteristics: Antigen Size: 589 amino acids

Molecular Weight: 62kDa

Application Details

Application Notes: WB Suggested Anti-ARSE Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ARSE Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta

Publications

Product: Nino, Matos-Miranda, Maeda et al.: "Clinical and molecular analysis of arylsulfatase E in patients with brachytelephalangic chondrodysplasia punctata." in: American journal of medical genetics. Part A, Vol. 146A, Issue 8, pp. 997-1008, 2008 (PubMed).