Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405475

Glutaminyl-tRNA Synthase (Glutamine-Hydrolyzing)-Like 1 (QRSL1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2700038P16Rik, C80053, GatA, wu:fi03b10, 0929/02, CG6007, Dmel\\CG6007, bene, benedict, l(3)S092902
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405475
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-QRSL1 antibody: synthetic peptide directed towards the middle region of human QRSL1
Sequence EFIKEDNRTRSAQDDIFTQAVNMAGLPAVSIPVALSNQGL PIGLQFIGRA
Predicted Reactivity Guinea pig : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Chicken : 92%
Characteristics This is a rabbit polyclonal antibody against QRSL1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name QRSL1
Background The function of the QRSL1 protein remains unknown.
Molecular Weight 57kDa
Gene ID 55278
NCBI Accession NP_060762, NM_018292
UniProt Q9H0R6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-QRSL1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Alternatives for antigen "Glutaminyl-tRNA Synthase (Glutamine-Hydrolyzing)-Like 1 (QRSL1)", type "Antibodies"
Hosts (10), (1)
Reactivities (9), (2), (2)
Applications (11), (4), (1)
Epitopes (5), (2), (1), (1), (1)
Beacon