erythroblast Membrane-Associated Protein (Scianna Blood Group) (ERMAP) (Middle Region) antibody

Details for Product No. ABIN405478
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PRO2801, RD, SC
Epitope
Middle Region
(8), (7), (7), (4), (2), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(51), (18), (18), (1), (1), (1), (1), (1)
Host
Rabbit
(38), (15)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(36), (23), (17), (14), (4), (3), (3), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN405478
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ERMAP
Sequence PANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLD YEAGVISFYN
Predicted Reactivity Human : 100 %, Mouse : 100 %, Guinea pig : 90 %, Horse : 90 %, Rabbit : 90 %
Characteristics This is a rabbit polyclonal antibody against ERMAP. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ERMAP
Background ERMAP is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in the gene encoding ERMAP protein are responsible for the Scianna/Radin blood group system. The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene.
Molecular Weight 52 kDa
Gene ID 114625
NCBI Accession NM_018538, NP_061008
UniProt Q96PL5
Research Area Stem Cells, Hematopoietic Progenitors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 475 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-erythroblast Membrane-Associated Protein (Scianna Blood Group) (ERMAP) (Middle Region) antibody WB Suggested Anti-ERMAP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate
Background publications Flegel, Chen, Reid et al.: "SCER and SCAN: two novel high-prevalence antigens in the Scianna blood group system." in: Transfusion, Vol. 45, Issue 12, pp. 1940-4, 2005 (PubMed).

Hosts (38), (15)
Reactivities (51), (18), (18), (1), (1), (1), (1), (1)
Applications (36), (23), (17), (14), (4), (3), (3), (2), (2)
Conjugates (3), (3), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (7), (7), (4), (2), (2), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top