Chromosome 6 Open Reading Frame 134 (C6orf134) (Middle Region) antibody

Details for Product No. ABIN405492
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms C6orf134, MEC17, Nbla00487, TAT, C7H6ORF134, C23H6orf134, Alpha-TAT, C4H6orf134, c6orf134, mec17
Epitope
Middle Region
(4), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Dog (Canine), Human
(19), (15), (13), (13), (13), (13)
Host
Rabbit
(22), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(14), (10), (3), (3), (1)
Pubmed 2 references available
Catalog no. ABIN405492
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C6orf134
Sequence DDREAHNEVEPLCILDFYIHESVQRHGHGRELFQYMLQKE RVEPHQLAID
Predicted Reactivity Human :100 %,   Mouse :100 %,   Rat :100 %,   Sumatran orangutan :100 %,   Rhesus macaque :100 %,   Bovine :90 %,   Pig :90 %,   Dog :80 %,  
Characteristics This is a rabbit polyclonal antibody against C6orf134. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C6orf134
Background The exact function of C6orf134 remains unknown.
Molecular Weight 36 kDa
Gene ID 79969
NCBI Accession NM_024909, NP_079185
UniProt Q5SQI0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 323 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 6 Open Reading Frame 134 (C6orf134) (Middle Region) antibody WB Suggested Anti-C6orf134 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Hosts (22), (1)
Reactivities (19), (15), (13), (13), (13), (13)
Applications (14), (10), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (1)
back to top