Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405492

Chromosome 6 Open Reading Frame 134 (C6orf134) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C6orf134, MEC17, Nbla00487, TAT, C7H6ORF134, C23H6orf134, Alpha-TAT, C4H6orf134, c6orf134, mec17
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN405492
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C6orf134 antibody: synthetic peptide directed towards the middle region of human C6orf134
Sequence DDREAHNEVEPLCILDFYIHESVQRHGHGRELFQYMLQKE RVEPHQLAID
Predicted Reactivity Human :100%,   Mouse :100%,   Rat :100%,   Sumatran orangutan :100%,   Rhesus macaque :100%,   Bovine :92%,   Pig :92%,   Dog :85%,  
Characteristics This is a rabbit polyclonal antibody against C6orf134. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C6orf134
Background The exact function of C6orf134 remains unknown.
Molecular Weight 36kDa
Gene ID 79969
NCBI Accession NP_079185, NM_024909
UniProt Q5SQI0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C6orf134 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Alternatives for antigen "Chromosome 6 Open Reading Frame 134 (C6orf134)", type "Antibodies"
Hosts (22)
Reactivities (18), (15), (13), (13), (13), (13)
Applications (13), (10), (4), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (1)
Beacon