Did you know that you can buy products from over 140 different suppliers from us?

Ubiquitin-Conjugating Enzyme E2S (UBE2S) (N-Term) antibody

Details for Product No. ABIN405528
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EPF5, E2EPF, E2-EPF, 0910001J09Rik, 6720465F12Rik, AA409170, RGD1564746, UBE2S, ube2s, DDBDRAFT_0188215, DDBDRAFT_0305006, DDB_0188215, DDB_0305006
Epitope
N-Term
(16), (15), (10), (9), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Human
(79), (16), (16), (13), (13), (12)
Host
Rabbit
(53), (24), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(4), (4), (4), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(58), (41), (18), (11), (10), (9), (4), (3), (3), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405528
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human UBE2S
Sequence NSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLT DLQVTIEGPE
Predicted Reactivity Bovine : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against UBE2S. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name UBE2S
Background UBE2S is a member of the ubiquitin-conjugating enzyme family. It is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins.This gene encodes a member of the ubiquitin-conjugating enzyme family. The encoded protein is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins.
Molecular Weight 24 kDa
Gene ID 27338
NCBI Accession NM_014501, NP_055316
UniProt Q16763
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 222 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ubiquitin-Conjugating Enzyme E2S (UBE2S) (N-Term) antibody WB Suggested Anti-UBE2S Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Product cited in: Marques, Dupanloup, Vinckenbosch et al.: "Emergence of young human genes after a burst of retroposition in primates." in: PLoS biology, Vol. 3, Issue 11, pp. e357, 2005 (PubMed).

Hosts (53), (24), (4)
Reactivities (79), (16), (16), (13), (13), (12)
Applications (58), (41), (18), (11), (10), (9), (4), (3), (3), (2), (1)
Conjugates (4), (4), (4), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (16), (15), (10), (9), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405528
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top