Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405528

Ubiquitin-Conjugating Enzyme E2S (UBE2S) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EPF5, E2EPF, E2-EPF, 0910001J09Rik, 6720465F12Rik, AA409170, RGD1564746, UBE2S, ube2s, DDBDRAFT_0188215, DDBDRAFT_0305006, DDB_0188215, DDB_0305006
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405528
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-UBE2S antibody: synthetic peptide directed towards the N terminal of human UBE2S
Sequence NSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLT DLQVTIEGPE
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against UBE2S. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name UBE2S
Background UBE2S is a member of the ubiquitin-conjugating enzyme family. It is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins.This gene encodes a member of the ubiquitin-conjugating enzyme family. The encoded protein is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins.
Molecular Weight 24kDa
Gene ID 27338
NCBI Accession NP_055316, NM_014501
UniProt Q16763
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-UBE2S antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Marques, Dupanloup, Vinckenbosch et al.: "Emergence of young human genes after a burst of retroposition in primates." in: PLoS biology, Vol. 3, Issue 11, pp. e357, 2005 (PubMed).

Alternatives for antigen "Ubiquitin-Conjugating Enzyme E2S (UBE2S)", type "Antibodies"
Hosts (32), (19), (5)
Reactivities (59), (15), (15), (13), (13), (12)
Applications (38), (25), (11), (10), (9), (7), (3), (3), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (9), (6), (2), (2), (2)
Beacon