Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Ubiquitin-Conjugating Enzyme E2S (UBE2S) antibody

Antigen

Ubiquitin-Conjugating Enzyme E2S (UBE2S)
Synonyms EPF5, E2EPF, E2-EPF, AA409170, MGC101982, 0910001J09Rik, 6720465F12Rik, RGD1564746, UBE2S, ube2s, MGC114060
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405528
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Ubiquitin-Conjugating Enzyme E2S (UBE2S) antibody

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name UBE2S
Gene ID UBE2S
UniProt Q16763
Immunogen The immunogen for anti-UBE2S antibody: synthetic peptide directed towards the N terminal of human UBE2S
Sequence NSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLT DLQVTIEGPE
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-UBE2S antibody concentration is 1 mg/ml.
Description UBE2S is a member of the ubiquitin-conjugating enzyme family. It is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins.This gene encodes a member of the ubiquitin-conjugating enzyme family. The encoded protein is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins.
Characteristics Antigen Size: 222 amino acids
Molecular Weight 24kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-UBE2S Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Marques, Dupanloup, Vinckenbosch et al.: "Emergence of young human genes after a burst of retroposition in primates." in: PLoS biology, Vol. 3, Issue 11, pp. e357, 2005 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "Ubiquitin-Conjugating Enzyme E2S (UBE2S)", type "Antibodies"
Hosts Rabbit (34), Mouse (10), Goat (3)
Reactivities Human (45), Rat (Rattus) (25), Mouse (Murine) (23), Cow (Bovine) (20), Pig (Porcine) (20), Dog (Canine) (18), Horse (Equine) (18), Rabbit (2)
Applications ELISA (26), Western Blotting (WB) (25), Immunofluorescence (IF) (22), Immunohistochemistry (IHC) (8), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (7), Immunocytochemistry (ICC) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoprecipitation (IP) (3), Dot Blot (DB) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (4), AA 1-222 (2), C-Term (2)