Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Ring Finger Protein 20 (RNF20) antibody

Antigen

Ring Finger Protein 20 (RNF20)

Synonyms BRE1, BRE1A, hBRE1, FLJ11189, FLJ20382, KIAA2779, MGC129667, MGC129668
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405542
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name BRE1A / RNF20
Gene ID RNF20
UniProt Q5VTR2
Immunogen The immunogen for anti-RNF20 antibody: synthetic peptide directed towards the N terminal of human RNF20
Sequence LKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQERKDDRE RGEGQEPAFS
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-RNF20 antibody concentration is 1 mg/ml.
Description RNF20 shares similarity with BRE1 of S. cerevisiae. Yeast BRE1 is an ubiquitin ligase required for the ubiquitination of histone H2B and the methylation of histone H3. The protein encoded by this gene shares similarity with BRE1 of S. cerevisiae. Yeast BRE1 is a ubiquitin ligase required for the ubiquitination of histone H2B and the methylation of histone H3. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Characteristics Antigen Size: 975 amino acids
Molecular Weight 114kDa

Application Details

Application Notes WB Suggested Anti-RNF20 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Barber, McManus, Yuen et al.: "Chromatid cohesion defects may underlie chromosome instability in human colorectal cancers." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 9, pp. 3443-8, 2008 (PubMed).

Alternatives

Alternatives for antigen "Ring Finger Protein 20 (RNF20)", type "Antibodies"
Hosts Rabbit (30), Mouse (1)
Reactivities Human (28), Mouse (Murine) (21), Rat (Rattus) (21), Chicken (19), Cow (Bovine) (1), Dog (Canine) (1)
Applications Immunofluorescence (IF) (16), Western Blotting (WB) (15), ELISA (10), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoprecipitation (IP) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes N-Term (2), AA 1-50 (1), AA 125-175 (1), Internal Region (1)