Ring Finger Protein 133 (RNF133) antibody

Antigen: Ring Finger Protein 133 (RNF133)

Synonyms: MGC27072

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN405559

Additional Information

Alternative name: RNF133

Gene ID: RNF133

UniProt: Q8WVZ7

Immunogen: The immunogen for anti-RNF133 antibody: synthetic peptide directed towards the N terminal of human RNF133

Sequence: VVWMAYMNISFHVGNHVLSELGETGVFGRSSTLKRVAGVI VPPEGKIQNA

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RNF133 antibody concentration is 1 mg/ml.

Description: RNF133 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene has no intron.

Characteristics: Antigen Size: 376 amino acids

Molecular Weight: 42kDa

Application Details

Application Notes: WB Suggested Anti-RNF133 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Proteolysis / Ubiquitin

Restrictions: For Research Use only

Images

WB Suggested Anti-RNF133 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain

Publications

Product: Saurin, Borden, Boddy et al.: "Does this have a familiar RING?" in: Trends in biochemical sciences, Vol. 21, Issue 6, pp. 208-14, 1996 (PubMed).