Did you know that you can buy products from over 140 different suppliers from us?

HECT Domain Containing 2 (HECTD2) (C-Term) antibody

Details for Product No. ABIN405565
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms hmm77879, HECTD2, DKFZp459J1430, 4921524L07, A630025O09Rik, AW212605
Epitope
C-Term
(10), (7), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Fruit Fly (Drosophila melanogaster), Human
(20), (1)
Host
Rabbit
(18), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(23), (9), (3), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405565
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human HECTD2
Sequence TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMAD LNFKISKNET
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Chicken : 90 %
Characteristics This is a rabbit polyclonal antibody against HECTD2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name HECTD2
Background HECTD2 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Molecular Weight 88 kDa
Gene ID 143279
NCBI Accession NM_182765, NP_877497
UniProt Q5RD78
Research Area Proteolysis / Ubiquitin
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 776 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Validation Images
back to top