Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405569

Ring Finger Protein 148 (RNF148) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4933432M07Rik, Greul3
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405569
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RNF148 antibody: synthetic peptide directed towards the C terminal of human RNF148
Sequence PNSFTRRRSQIKTDVKKAIDQLQLRVLKEGDEELDLNEDN CVVCFDTYKP
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against RNF148. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RNF148
Background RNF148 is a single-pass membrane protein. It contains 1 PA (protease associated) domain and 1 RING-type zinc finger. The exact function of RNF148 remains unknown.
Molecular Weight 34kDa
Gene ID 378925
NCBI Accession NP_932351, NM_198085
UniProt Q8N7C7
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RNF148 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Saurin, Borden, Boddy et al.: "Does this have a familiar RING?" in: Trends in biochemical sciences, Vol. 21, Issue 6, pp. 208-14, 1996 (PubMed).

Alternatives for antigen "Ring Finger Protein 148 (RNF148)", type "Antibodies"
Hosts (6), (1)
Reactivities (6)
Applications (7), (3)
Epitopes (5), (2), (2), (1)
Beacon