Ring Finger Protein 148 (RNF148) (C-Term) antibody

Details for Product No. ABIN405569
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 4933432M07Rik, Greul3
Epitope
C-Term
(2), (2)
Reactivity
Human
(3)
Host
Rabbit
(4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(4), (1)
Pubmed 1 reference available
Catalog no. ABIN405569
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human RNF148
Sequence PNSFTRRRSQIKTDVKKAIDQLQLRVLKEGDEELDLNEDN CVVCFDTYKP
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against RNF148. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RNF148
Background RNF148 is a single-pass membrane protein. It contains 1 PA (protease associated) domain and 1 RING-type zinc finger. The exact function of RNF148 remains unknown.
Molecular Weight 34 kDa
Gene ID 378925
NCBI Accession NM_198085, NP_932351
UniProt Q8N7C7
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 305 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Saurin, Borden, Boddy et al.: "Does this have a familiar RING?" in: Trends in biochemical sciences, Vol. 21, Issue 6, pp. 208-14, 1996 (PubMed).

Hosts (4)
Reactivities (3)
Applications (4), (1)
Epitopes (2), (2)
back to top