Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Ring Finger Protein 148 (RNF148) antibody

Antigen

Ring Finger Protein 148 (RNF148)

Synonyms MGC35222
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405569
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name RNF148
Gene ID RNF148
Immunogen The immunogen for anti-RNF148 antibody: synthetic peptide directed towards the C terminal of human RNF148
Sequence PNSFTRRRSQIKTDVKKAIDQLQLRVLKEGDEELDLNEDN CVVCFDTYKP
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-RNF148 antibody concentration is 1 mg/ml.
Description RNF148 is a single-pass membrane protein. It contains 1 PA (protease associated) domain and 1 RING-type zinc finger. The exact function of RNF148 remains unknown.
Characteristics Antigen Size: 305 amino acids
Molecular Weight 34kDa

Application Details

Application Notes WB Suggested Anti-RNF148 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Saurin, Borden, Boddy et al.: "Does this have a familiar RING?" in: Trends in biochemical sciences, Vol. 21, Issue 6, pp. 208-14, 1996 (PubMed).

Alternatives

Alternatives for antigen "Ring Finger Protein 148 (RNF148)", type "Antibodies"
Hosts Rabbit (22)
Reactivities Human (21), Dog (Canine) (18), Horse (Equine) (18), Mouse (Murine) (18), Rat (Rattus) (18)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (7), ELISA (6), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (3)