Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Solute Carrier Family 27 (Fatty Acid Transporter), Member 6 (SLC27A6) antibody

Antigen

Solute Carrier Family 27 (Fatty Acid Transporter), Member 6 (SLC27A6)

Synonyms FATP6, FACVL2, VLCS-H1, 4732438L20Rik, fatp6, acsvl2, facvl2, slc27a2, vlcs-h1, MGC153783, zgc:153783, MGC154930
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish, Dog (Canine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405592
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name SLC27A6 / FATP6
Gene ID SLC27A6
UniProt Q9Y2P4
Immunogen The immunogen for anti-SLC27A6 antibody: synthetic peptide directed towards the middle region of human SLC27A6
Sequence KSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTA HDIVYITLPL
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-SLC27A6 antibody concentration is 1 mg/ml.
Description SLC27A6 is a member of the fatty acid transport protein family (FATP). FATPs are involved in the uptake of long-chain fatty acids and have unique expression patterns. Alternatively spliced transcript variants encoding the same protein have been found for this gene.This gene encodes a member of the fatty acid transport protein family (FATP). FATPs are involved in the uptake of long-chain fatty acids and have unique expression patterns. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Characteristics Antigen Size: 619 amino acids
Molecular Weight 70kDa

Application Details

Application Notes WB Suggested Anti-SLC27A6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Alternatives

Alternatives for antigen "Solute Carrier Family 27 (Fatty Acid Transporter), Member 6 (SLC27A6)", type "Antibodies"
Hosts Rabbit (19)
Reactivities Chicken (18), Cow (Bovine) (18), Dog (Canine) (18), Fruit Fly (Drosophila melanogaster) (18), Human (18), Mouse (Murine) (18), Pig (Porcine) (18), Rat (Rattus) (18), Zebrafish (Danio rerio) (18)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (4), ELISA (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)