Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405613

Solute Carrier Family 25, Member 36 (SLC25A36) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PNC2, C330005L02Rik, slc25a36, slc25a36a, MGC131068, slc25a36b, DKFZp459O044
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405613
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SLC25A36 antibody: synthetic peptide directed towards the N terminal of human SLC25A36
Sequence SSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKE GPRSLFRGLG
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Guinea pig : 92%, African clawed frog : 87%, Zebrafish : 78%
Characteristics This is a rabbit polyclonal antibody against SLC25A36. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SLC25A36
Background SLC25A36 belongs to the mitochondrial carrier family. It contains 3 Solcar repeats. SLC25A36 is a multi-pass membrane protein. The function of the SLC25A36 protein remains unknown.
Molecular Weight 34kDa
Gene ID 55186
NCBI Accession NP_060625, NM_018155
UniProt Q96CQ1-3
Research Area Signaling, Metabolism, Organelles
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SLC25A36 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Alternatives for antigen "Solute Carrier Family 25, Member 36 (SLC25A36)", type "Antibodies"
Hosts (4), (3)
Reactivities (6)
Applications (7), (3), (1)
Epitopes (3), (2), (1)
Beacon