Did you know that you can buy products from over 140 different suppliers from us?

Solute Carrier Family 25, Member 36 (SLC25A36) (N-Term) antibody

Details for Product No. ABIN405613
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PNC2, C330005L02Rik, slc25a36, slc25a36a, MGC131068, slc25a36b, DKFZp459O044
Epitope
N-Term
(3), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Human, Chicken
(5)
Host
Rabbit
(3), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405613
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SLC25A36
Sequence SSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKE GPRSLFRGLG
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Guinea pig : 90 %, African clawed frog : 80 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against SLC25A36. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SLC25A36
Background SLC25A36 belongs to the mitochondrial carrier family. It contains 3 Solcar repeats. SLC25A36 is a multi-pass membrane protein. The function of the SLC25A36 protein remains unknown.
Molecular Weight 34 kDa
Gene ID 55186
NCBI Accession NM_018155, NP_060625
UniProt Q96CQ1-3
Research Area Signaling, Metabolism, Organelles
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 310 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome...." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405613
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top