Solute Carrier Family 25, Member 36 (SLC25A36) antibody

Antigen: Solute Carrier Family 25, Member 36 (SLC25A36)

Synonyms: FLJ10618, DKFZp564C053, C330005L02Rik, MGC131068, slc25a36b, slc25a36a, DKFZp459O044

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN405613

Additional Information

Alternative name: SLC25A36

Gene ID: SLC25A36

UniProt: Q96CQ1-3

Immunogen: The immunogen for anti-SLC25A36 antibody: synthetic peptide directed towards the N terminal of human SLC25A36

Sequence: SSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKE GPRSLFRGLG

Cross-Reactivity: Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SLC25A36 antibody concentration is 1 mg/ml.

Description: SLC25A36 belongs to the mitochondrial carrier family. It contains 3 Solcar repeats. SLC25A36 is a multi-pass membrane protein. The function of the SLC25A36 protein remains unknown.

Characteristics: Antigen Size: 310 amino acids

Molecular Weight: 34kDa

Application Details

Application Notes: WB Suggested Anti-SLC25A36 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Metabolism, Organelles

Restrictions: For Research Use only

Images

WB Suggested Anti-SLC25A36 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle

Publications

Product: Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).