Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405659

Transmembrane Protein 195 (TMEM195) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TMEM195, A530016O06Rik, AI790538, Tmem195, RGD1312038
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405659
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TMEM195 antibody: synthetic peptide directed towards the N terminal of human TMEM195
Sequence MKNPEAQQDVSVSQGFRMLFYTMKPSETSFQTLEEVPDYV KKATPFFISL
Predicted Reactivity Rat :100%,   Mouse :100%,   Human :100%,   Dog :92%,  
Characteristics This is a rabbit polyclonal antibody against TMEM195. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TMEM195
Background TMEM195 belongs to the TMEM195 family.It is a multi-pass membrane protein. The function of the TMEM195 protein remains.
Molecular Weight 51kDa
Gene ID 392636
NCBI Accession NP_001004320, NM_001004320
UniProt Q6ZNB7
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TMEM195 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Alternatives for antigen "Transmembrane Protein 195 (TMEM195)", type "Antibodies"
Hosts (8)
Reactivities (5), (1), (1), (1)
Applications (8), (2)
Epitopes (3), (1), (1)
Beacon