Did you know that you can buy products from over 140 different suppliers from us?

Transmembrane Protein 195 (TMEM195) (N-Term) antibody

Details for Product No. ABIN405660
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TMEM195, A530016O06Rik, AI790538, Tmem195, RGD1312038
Epitope
N-Term
(3), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(5), (1), (1), (1)
Host
Rabbit
(8)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405660
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TMEM195
Sequence VPDYVKKATPFFISLMLLELVVSWILKGKPPGRLDDALTS ISAGVLSRLP
Predicted Reactivity Mouse :100 %,   Dog :100 %,   Human :100 %,   Rat :80 %,  
Characteristics This is a rabbit polyclonal antibody against TMEM195. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TMEM195
Background TMEM195 belongs to the TMEM195 family.It is a multi-pass membrane protein. The function of the TMEM195 protein remains.
Molecular Weight 51 kDa
Gene ID 392636
NCBI Accession NM_001004320, NP_001004320
UniProt Q6ZNB7
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 445 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Transmembrane Protein 195 (TMEM195) (N-Term) antibody WB Suggested Anti-TMEM195 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405660
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top