Transmembrane Protein 195 (TMEM195) antibody

Antigen: Transmembrane Protein 195 (TMEM195)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN405660

Additional Information

Alternative name: TMEM195

Gene ID: TMEM195

UniProt: Q6ZNB7

Immunogen: The immunogen for anti-TMEM195 antibody: synthetic peptide directed towards the N terminal of human TMEM195

Sequence: VPDYVKKATPFFISLMLLELVVSWILKGKPPGRLDDALTS ISAGVLSRLP

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TMEM195 antibody concentration is 1 mg/ml.

Description: TMEM195 belongs to the TMEM195 family.It is a multi-pass membrane protein. The function of the TMEM195 protein remains.

Characteristics: Antigen Size: 445 amino acids

Molecular Weight: 51kDa

Application Details

Application Notes: WB Suggested Anti-TMEM195 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TMEM195 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate

Publications

Product: Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).