Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

tyrosylprotein Sulfotransferase 2 (TPST2) antibody

Antigen

tyrosylprotein Sulfotransferase 2 (TPST2)

Synonyms grm, grt, D5Ucla3, AI448750, MGC105657, MGC64196, zgc:64196, MGC127125
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Fruit Fly (Drosophila melanogaster)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405668
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name TPST2
Gene ID TPST2
UniProt O60704
Immunogen The immunogen for anti-TPST2 antibody: synthetic peptide directed towards the middle region of human TPST2
Sequence KAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDF LGIAWSDAVL
Cross-Reactivity Cow (Bovine), Chicken, Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-TPST2 antibody concentration is 1 mg/ml.
Description TPST2 catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. TPST2 is a type II integral membrane protein found in the Golgi body.The protein encoded by this gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Two transcript variants encoding the same protein have been found for this gene.
Characteristics Antigen Size: 377 amino acids
Molecular Weight 42kDa

Application Details

Application Notes WB Suggested Anti-TPST2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Cardiovascular, Atherosclerosis, Organelles
Restrictions For Research Use only

Publications

Product Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives

Alternatives for antigen "tyrosylprotein Sulfotransferase 2 (TPST2)", type "Antibodies"
Hosts Rabbit (30)
Reactivities Human (28), Mouse (Murine) (21), Rat (Rattus) (20), Cow (Bovine) (17)
Applications Immunofluorescence (IF) (14), Western Blotting (WB) (14), ELISA (13), Immunohistochemistry (IHC) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (2), N-Term (2), Internal Region (1)