Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405680

Arylsulfatase H (ARSH) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms sulfatase, ARSH, ARSD, ARSF, LOC100232370
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405680
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ARSH antibody: synthetic peptide directed towards the middle region of human ARSH
Sequence FIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGD NVEEMDWMVG
Predicted Reactivity Human : 100%, Dog : 85%, Horse : 85%, Bovine : 78%
Characteristics This is a rabbit polyclonal antibody against ARSH. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ARSH
Background Sulfatases, such as ARSH, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules.Sulfatases, such as ARSH, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules (Sardiello et al., 2005 [PubMed 16174644]).
Molecular Weight 63kDa
Gene ID 347527
NCBI Accession NP_001011719, NM_001011719
UniProt Q5FYA8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ARSH antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Sardiello, Annunziata, Roma et al.: "Sulfatases and sulfatase modifying factors: an exclusive and promiscuous relationship." in: Human molecular genetics, Vol. 14, Issue 21, pp. 3203-17, 2005 (PubMed).

Alternatives for antigen "Arylsulfatase H (ARSH)", type "Antibodies"
Hosts (14), (5), (1)
Reactivities (16), (2)
Applications (10), (8), (7), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1)
Beacon