Did you know that you can buy products from over 140 different suppliers from us?

Arylsulfatase H (ARSH) (Middle Region) antibody

Details for Product No. ABIN405680
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms sulfatase, ARSH, ARSD, ARSF, LOC100232370
Epitope
Middle Region
(2), (2)
Reactivity
Rat (Rattus), Dog (Canine), Human
(17), (1)
Host
Rabbit
(14), (3), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (7), (5), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405680
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ARSH
Sequence FIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGD NVEEMDWMVG
Predicted Reactivity Human : 100 %, Dog : 80 %, Horse : 80 %, Bovine : 70 %
Characteristics This is a rabbit polyclonal antibody against ARSH. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ARSH
Background Sulfatases, such as ARSH, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules.Sulfatases, such as ARSH, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules (Sardiello et al., 2005 [PubMed 16174644]).
Molecular Weight 63 kDa
Gene ID 347527
NCBI Accession NM_001011719, NP_001011719
UniProt Q5FYA8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 562 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Arylsulfatase H (ARSH) (Middle Region) antibody WB Suggested Anti-ARSH Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate
Background publications Sardiello, Annunziata, Roma et al.: "Sulfatases and sulfatase modifying factors: an exclusive and promiscuous relationship." in: Human molecular genetics, Vol. 14, Issue 21, pp. 3203-17, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405680
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top